Skip to content

Noble-Lab/FDRBench

Folders and files

NameName
Last commit message
Last commit date

Latest commit

 

History

26 Commits
 
 
 
 
 
 
 
 
 
 

Repository files navigation

FDRBench is a tool for false discovery rate (FDR) control evaluation in proteomics. It provides two main functions: (1) build entrapment databases using randomly shuffled target sequences or using sequences from foreign species, and (2) estimate the false discovery proportion (FDP) using the lower bound, combined, and paired methods.

Downloads ReleaseDownloads

FDRBench

Installation

FDRBench is written using Java and can be run on Windows, Mac OS and Linux. Only Java is required to be installed to run FDRBench. If java is not installed, please install Java by following the instruction at https://openjdk.org/install/ or https://www.oracle.com/java/technologies/downloads/. After java is installed, FDRBench can be downloaded at https://github.com/Noble-Lab/FDRBench/releases.

Usage

$ java -jar fdrbench-0.0.2.jar
usage: Options
 -db <arg>                 Protein database file
 -crux <arg>               The peptide list generated by Crux
 -target_pep <arg>         The target peptide list to consider
 -decoy                    Add decoy or not
 -clip_n_m                 When digesting a protein starting with amino acid M, two copies of the
                           leading peptides (with and without the N-terminal M) are considered or
                           not. Default is false.
 -fix_nc <arg>             Fix N/C terminal amino acid. n/N: only N terminal, c/C: only C terminal
                           and nc/NC/cn/CN: both (default)
 -o <arg>                  Output file
 -I2L                      Convert I to L
 -diann                    For DIA-NN
 -uniprot                  For Uniprot
 -prosit                   Generate Prosit input file
 -charge <arg>             For prosit input: charge range, 2,3,4
 -nce <arg>                For prosit input: NCE
 -enzyme <arg>             Enzyme used for protein digestion. 0:Non-specific, 1:Trypsin, 2:Trypsin (no
                           P rule) (default), 3:Arg-C, 4:Arg-C (no P rule), 5:Arg-N, 6:Glu-C,
                           7:Lys-C, 8: NoCut
 -miss_c <arg>             The max missed cleavages, default is 1
 -minLength <arg>          The minimum length of peptide to consider, default is 7
 -maxLength <arg>          The maximum length of peptide to consider, default is 35
 -export_db                Export protein database or not
 -seed <arg>               Random seed for generating decoy peptides
 -fix_seed                 Use a fixed random seed for all decoy peptides generation
 -fold <arg>               The number of folds for generating entrapment proteins/peptides
 -r <arg>                  For FDP calculation: #entrapment/#target
 -use_v1 <arg>             Use the first version of FDP calculation for 1-fold
 -pick <arg>               If a group has multiple proteins, how to peak one protein: first
                           (default),last,random
 -a                        Generate entrapment protein(s) for each target protein independently
 -check                    Checking for duplicates and random shuffling
 -method <arg>             The method to generate a random peptide: 0:shuffle (default), 1:swap
 -ms <arg>                 Multiple species entrapment: Fasta files of foreign species
 -ns                       no shared peptides between entrapment and target protein
 -swap                     Reverse the order of generated random peptide sequences
 -i <arg>                  PSM/peptide/precursor/protein file
 -score <arg>              The score name for ranking precursor/peptide/protein for FDP calculation.
                           The format could be "score", "score:0" or "score:1". The second part is 0
                           or 1, 0: lower is better, 1: higher is better
 -level <arg>              PSM, peptide, precursor or protein
 -pep <arg>                peptide/protein pair file
 -decoy_label <arg>        Label for decoy: rev_ in default
 -decoy_pos <arg>          Position of decoy label: 0 (start, in default); 1 (end)
 -entrapment_label <arg>   Label for entrapment: _p_target in default
 -entrapment_pos <arg>     Position of entrapment label: 0 (start); 1 (end, in default)
 -debug                    Print detailed information for debugging
 -h                        Print this usage information

Build entrapment databases

Build entrapment databases using randomly shuffled target sequences - peptide level:

Generate a peptide level entrapment database using the human target database UP000005640_9606.fasta (~20k human proteins). The database can be downloaded from UniProt.

java -jar fdrbench-0.0.1.jar -I2L -level peptide -db UP000005640_9606.fasta -o UP000005640_9606_entrapment_pep.txt -uniprot -diann -fix_nc c

Using the above command line, a peptide level entrapment database in FASTA format "UP000005640_9606_entrapment_pep.fasta" and a peptide tsv format file "UP000005640_9606_entrapment_pep.txt" will be generated:

The format of the Fasta file "UP000005640_9606_entrapment_pep.fasta" looks like below. The Fasta header of each peptide sequence in the file contains "_target" when the sequence is an original target or "_p_target" when the sequence is an entrapment peptide.

>sp|PSLDQLAAHPWMLGADGGVPESCDLR_target|PSLDQLAAHPWMLGADGGVPESCDLR_target
PSLDQLAAHPWMLGADGGVPESCDLR
>sp|PALLAVGGADSLLEDGHQPCSWDMPR_p_target|PALLAVGGADSLLEDGHQPCSWDMPR_p_target
PALLAVGGADSLLEDGHQPCSWDMPR
>sp|QLQGASWELQSLR_target|QLQGASWELQSLR_target
QLQGASWELQSLR
>sp|QQSWLSLQGLEAR_p_target|QQSWLSLQGLEAR_p_target
QQSWLSLQGLEAR
>sp|YPERDNR_target|YPERDNR_target
YPERDNR

The format of the tsv file "UP000005640_9606_entrapment_pep.txt" looks like below. This file is used in FDP calculation.

sequence                    decoy  proteins                                 peptide_type  peptide_pair_index
PSLDQLAAHPWMLGADGGVPESCDLR  No     sp|Q86V86|PIM3_HUMAN                     target        0
PALLAVGGADSLLEDGHQPCSWDMPR  No     sp|Q86V86_p_target|PIM3_HUMAN_p_target   p_target      0
QLQGASWELQSLR               No     sp|Q96N95|ZN396_HUMAN                    target        1
QQSWLSLQGLEAR               No     sp|Q96N95_p_target|ZN396_HUMAN_p_target  p_target      1
YPERDNR                     No     sp|Q5T200|ZC3HD_HUMAN                    target        2
YDRPENR                     No     sp|Q5T200_p_target|ZC3HD_HUMAN_p_target  p_target      2
SYKALADQMNLLLSK             No     sp|Q9UBJ2|ABCD2_HUMAN                    target        3
YSALSNMDLQKLALK             No     sp|Q9UBJ2_p_target|ABCD2_HUMAN_p_target  p_target      3

Below please find the description of each column in the output tsv file "UP000005640_9606_entrapment_pep.txt":

Column name Description
sequence peptide sequence (original target peptide or entrapment peptide)
decoy decoy peptide (Yes) or not (No)
proteins protein ID (multiple IDs are separated by ";")
peptide_type peptide type, original target (target) or entrapment (p_target)
peptide_pair_index peptide pair index: an original target peptide and its paired entrapment have the same index

The above example command line took about 30 seconds to run on a Mac MacBook computer.

Build entrapment databases using randomly shuffled target sequences - protein level:

Generate a protein level entrapment database using the human target database UP000005640_9606.fasta (~20k human proteins). The database can be downloaded from UniProt:

java -jar fdrbench-0.0.1.jar -level protein -db UP000005640_9606.fasta -o UP000005640_9606_I2L_entrapment.fasta -I2L -diann -uniprot -fix_nc c -check

Using the above command line, a protein level entrapment database in FASTA format "UP000005640_9606_I2L_entrapment.fasta" will be generated. For each target human protein, an entrapment protein is generated.

The format of the Fasta file "UP000005640_9606_I2L_entrapment.fasta" looks like below. The first protein as shown below is a target human protein while the second protein is its paired entrapment protein. Both command line parameters -diann and -uniprot are set in the command line, so an entrapment label "_p_target" is added in three positions of the Fasta protein header. This format is compatible with DIA-NN search.

>sp|A0A0G2JMI3|HV692_HUMAN Immunoglobulin heavy variable 1-69-2 OS=Homo sapiens OX=9606 GN=IGHV1-69-2 PE=3 SV=2
MDCTWRLLLLVAAATGTHAEVQLVQSGAEVKKPGATVKLSCKVSGYTFTDYYMHWVQQAPGKGLEWMGLVDPEDGETLYAEKFQGRVTLTADTSTDTAYMELSSLRSEDTAVYYCAT
>sp|A0A0G2JMI3_p_target|HV692_HUMAN_p_target Immunoglobulin heavy variable 1-69-2 OS=Homo sapiens OX=9606 GN=IGHV1-69-2_p_target PE=3 SV=2
CWTMDRTGAVEAVQVQAESAGLALTVLHLLKKTAGPVKCSLKYYMATPVDWTQQFSYVGHGKDAPGEEELDVMEGLGYLWTKQFGREAMLTLADYVLDSTTSTSTRDVTACESAYYT

The above example command line took about 10 seconds to run on a Mac MacBook computer.

Build entrapment databases using foreign species - peptide level:

Generate a peptide level entrapment database using the human target database UP000005640_9606.fasta (~20k human proteins) by taking peptides from Arabidopsis thaliana (UP000002311_559292.fasta) and Saccharomyces cerevisiae (UP000006548_3702.fasta) as entrapments. The database can be downloaded from UniProt.

java -jar fdrbench-0.0.1.jar java -db UP000005640_9606.fasta -o UP000005640_9606_I2L_foreign_species_entrapment_peptide.txt -I2L -diann -uniprot -ms UP000002311_559292.fasta,UP000006548_3702.fasta -enzyme 2 -miss_c 1 -minLength 7 -maxLength 35 -level peptide -fold 1
Build entrapment databases using foreign species - protein level:

Generate a protein level entrapment database using the human target database UP000005640_9606.fasta (~20k human proteins) by taking proteins from Arabidopsis thaliana (UP000002311_559292.fasta) and Saccharomyces cerevisiae (UP000006548_3702.fasta) as entrapments. The database can be downloaded from UniProt.

java -jar fdrbench-0.0.1.jar java -db UP000005640_9606.fasta -o UP000005640_9606_I2L_foreign_species_entrapment_protein.fasta -I2L -diann -uniprot -ms UP000002311_559292.fasta,UP000006548_3702.fasta -enzyme 2 -miss_c 1 -minLength 7 -maxLength 35 -level protein -fold 1

FDP calculation

Peptide (or precursor) level FDR control evaluation

For precursor level FDP calculation, an example input is shown below:

run                                                peptide                             mod_peptide                                     charge  q_value  PEP  protein                                    score
20230406_OLEP08_MMCC_1ug_MB_24min_AS_10ms_4Th_I_1  AAAPAPEEEMDECEQALAAEPK              AAAPAPEEEMDEC(UniMod:4)EQALAAEPK                3       1e-9     0    AAAPAPEEEMDECEQALAAEPK_target              1
20230406_OLEP08_MMCC_1ug_MB_24min_AS_10ms_4Th_I_1  AAASGQPRPEMQCPAEHEEDMYR             AAASGQPRPEMQC(UniMod:4)PAEHEEDMYR               4       1e-9     0    AAASGQPRPEMQCPAEHEEDMYR_target             2
20230406_OLEP08_MMCC_1ug_MB_24min_AS_10ms_4Th_I_1  AAEVWMDEYKNFYYAAVPSAR               AAEVWMDEYKNFYYAAVPSAR                           3       1e-9     0    AAEVWMDEYKNFYYAAVPSAR_target               3
20230406_OLEP08_MMCC_1ug_MB_24min_AS_10ms_4Th_I_1  AAFTVSLDPGPLEQFPHSMEPQLR            AAFTVSLDPGPLEQFPHSMEPQLR                        3       1e-9     0    AAFTVSLDPGPLEQFPHSMEPQLR_target            4
20230406_OLEP08_MMCC_1ug_MB_24min_AS_10ms_4Th_I_1  AAHVLMPHESTVEHTHVDLNEMESPLATR       AAHVLMPHESTVEHTHVDLNEMESPLATR                   4       1e-9     0    AAHVLMPHESTVEHTHVDLNEMESPLATR_target       5
20230406_OLEP08_MMCC_1ug_MB_24min_AS_10ms_4Th_I_1  AALLSPGDPALWAGLMAACHADDKLALVNNTQPK  AALLSPGDPALWAGLMAAC(UniMod:4)HADDKLALVNNTQPK    4       1e-9     0    AALLSPGDPALWAGLMAACHADDKLALVNNTQPK_target  6
20230406_OLEP08_MMCC_1ug_MB_24min_AS_10ms_4Th_I_1  AALQQKENLPVSSDGNLPQQAASAPSR         AALQQKENLPVSSDGNLPQQAASAPSR                     3       1e-9     0    AALQQKENLPVSSDGNLPQQAASAPSR_target         7
20230406_OLEP08_MMCC_1ug_MB_24min_AS_10ms_4Th_I_1  ADMLCNSQSNDLLQHQGSNCGGTSNK          ADMLC(UniMod:4)NSQSNDLLQHQGSNC(UniMod:4)GGTSNK  3       1e-9     0    ADMLCNSQSNDLLQHQGSNCGGTSNK_target          8
20230406_OLEP08_MMCC_1ug_MB_24min_AS_10ms_4Th_I_1  AFLADPSAFVAAAPVAAATTAAPAAAAAPAK     AFLADPSAFVAAAPVAAATTAAPAAAAAPAK                 3       1e-9     0    AFLADPSAFVAAAPVAAATTAAPAAAAAPAK_target     9

The required columns are described below. Decoy hits shouldn't be included in the input file for FDP calcualtion.

Column name Description
peptide peptide sequence
mod_peptide peptide modification (optional for peptide level FDR control evaluation)
charge precursor charge (optional for peptide level FDR control evaluation)
q_value FDR reported by the search engine used to generate the result
score precursor or peptide score used to rank precursor or peptide for FDR calculation

Below is an example command line to run precursor FDP calculation:

java -jar fdrbench-0.0.1.jar  -i peptide-fdp_precursor_input.tsv -fold 1 -pep UP000005640_9606_entrapment_pep.txt -level precursor -o peptide-diann_fdp_precursor.csv -score 'score:0' 

The output file "peptide-diann_fdp_precursor.csv" contains estimated FDP values using different methods. The file looks like below:

run                                                peptide                             mod_peptide                                     charge  q_value  PEP  protein                                    score  combined_fdp  n_t  n_p  paired_fdp  n_p_t_s  n_p_s_t  vt  lower_bound_fdp
20230406_OLEP08_MMCC_1ug_MB_24min_AS_10ms_4Th_I_1  AAAPAPEEEMDECEQALAAEPK              AAAPAPEEEMDEC(UniMod:4)EQALAAEPK                3       1.0E-9   0.0  AAAPAPEEEMDECEQALAAEPK_target              1      0.0           393  0    0.0         0        0        0   0.0
20230406_OLEP08_MMCC_1ug_MB_24min_AS_10ms_4Th_I_1  AAASGQPRPEMQCPAEHEEDMYR             AAASGQPRPEMQC(UniMod:4)PAEHEEDMYR               4       1.0E-9   0.0  AAASGQPRPEMQCPAEHEEDMYR_target             2      0.0           393  0    0.0         0        0        0   0.0
20230406_OLEP08_MMCC_1ug_MB_24min_AS_10ms_4Th_I_1  AAEVWMDEYKNFYYAAVPSAR               AAEVWMDEYKNFYYAAVPSAR                           3       1.0E-9   0.0  AAEVWMDEYKNFYYAAVPSAR_target               3      0.0           393  0    0.0         0        0        0   0.0
20230406_OLEP08_MMCC_1ug_MB_24min_AS_10ms_4Th_I_1  AAFTVSLDPGPLEQFPHSMEPQLR            AAFTVSLDPGPLEQFPHSMEPQLR                        3       1.0E-9   0.0  AAFTVSLDPGPLEQFPHSMEPQLR_target            4      0.0           393  0    0.0         0        0        0   0.0
20230406_OLEP08_MMCC_1ug_MB_24min_AS_10ms_4Th_I_1  AAHVLMPHESTVEHTHVDLNEMESPLATR       AAHVLMPHESTVEHTHVDLNEMESPLATR                   4       1.0E-9   0.0  AAHVLMPHESTVEHTHVDLNEMESPLATR_target       5      0.0           393  0    0.0         0        0        0   0.0
20230406_OLEP08_MMCC_1ug_MB_24min_AS_10ms_4Th_I_1  AALLSPGDPALWAGLMAACHADDKLALVNNTQPK  AALLSPGDPALWAGLMAAC(UniMod:4)HADDKLALVNNTQPK    4       1.0E-9   0.0  AALLSPGDPALWAGLMAACHADDKLALVNNTQPK_target  6      0.0           393  0    0.0         0        0        0   0.0
20230406_OLEP08_MMCC_1ug_MB_24min_AS_10ms_4Th_I_1  AALQQKENLPVSSDGNLPQQAASAPSR         AALQQKENLPVSSDGNLPQQAASAPSR                     3       1.0E-9   0.0  AALQQKENLPVSSDGNLPQQAASAPSR_target         7      0.0           393  0    0.0         0        0        0   0.0
20230406_OLEP08_MMCC_1ug_MB_24min_AS_10ms_4Th_I_1  ADMLCNSQSNDLLQHQGSNCGGTSNK          ADMLC(UniMod:4)NSQSNDLLQHQGSNC(UniMod:4)GGTSNK  3       1.0E-9   0.0  ADMLCNSQSNDLLQHQGSNCGGTSNK_target          8      0.0           393  0    0.0         0        0        0   0.0
20230406_OLEP08_MMCC_1ug_MB_24min_AS_10ms_4Th_I_1  AFLADPSAFVAAAPVAAATTAAPAAAAAPAK     AFLADPSAFVAAAPVAAATTAAPAAAAAPAK                 3       1.0E-9   0.0  AFLADPSAFVAAAPVAAATTAAPAAAAAPAK_target     9      0.0           393  0    0.0         0        0        0   0.0

Below please find the description of the main columns in the output tsv file "peptide-diann_fdp_precursor.csv":

Column name Description
peptide peptide sequence
mod_peptide peptide modification
charge precursor charge
q_value FDR reported by the search engine used to generate the result
score precursor score used to rank precursor for FDR calculation
combined_fdp the FDP estimated using the combined method
paired_fdp the FDP estimated using the paired method
lower_bound_fdp the lower bound FDP

The above example command line took about 30 seconds to run on a Mac MacBook computer.

Protein level FDR control evaluation

For protein level FDP calculation, an example input is shown below. Only the three columns protein, q_value and score are required. Decoy hits shouldn't be included in the input file for FDP calcualtion.

Protein.Group  PG.Q.Value  q_value     protein  score
P62857         1.64447e-4  1.64447e-4  P62857   1
P29590         1.64447e-4  1.64447e-4  P29590   2
O95989         1.64447e-4  1.64447e-4  O95989   3
P61006         1.64447e-4  1.64447e-4  P61006   4
Q70J99         1.64447e-4  1.64447e-4  Q70J99   5
P36404         1.64447e-4  1.64447e-4  P36404   6
Q71SY5         1.64447e-4  1.64447e-4  Q71SY5   7
Q9BPW8         1.64447e-4  1.64447e-4  Q9BPW8   8
Q8WUP2         1.64447e-4  1.64447e-4  Q8WUP2   9
Column name Description
protein protein ID (multiple IDs are separated by ";"). Each row is a protein group
q_value FDR reported by the search engine used to generate the result
score protein score used to rank protein for FDR calculation

Below is an example command line to run protein FDP calculation. The database used to generate the identification result must be generated using FDRBench. The command line parameter -score is set to use the column "score" as a secondary ranking score in FDP calculation. The number 0 indicates lower score is better (more confident). The example file protein-fdp_protein_input.tsv is available in the example folder.

java -jar fdrbench-0.0.1.jar -i example/protein-fdp_protein_input.tsv -level protein -o protein-diann_fdp_protein.csv -score 'score:0' -fold 1 -pick first

The output file "protein-diann_fdp_protein.csv" contains estimated FDP values using different methods. The file looks like below:

Protein.Group  PG.Q.Value  q_value     protein  score  combined_fdp  n_t   n_p  paired_fdp  n_p_t_s  n_p_s_t  vt  lower_bound_fdp
P62857         1.64447E-4  1.64447E-4  P62857   1      0.0           6079  0    0.0         0        0        0   0.0
P29590         1.64447E-4  1.64447E-4  P29590   2      0.0           6079  0    0.0         0        0        0   0.0
O95989         1.64447E-4  1.64447E-4  O95989   3      0.0           6079  0    0.0         0        0        0   0.0
P61006         1.64447E-4  1.64447E-4  P61006   4      0.0           6079  0    0.0         0        0        0   0.0
Q70J99         1.64447E-4  1.64447E-4  Q70J99   5      0.0           6079  0    0.0         0        0        0   0.0

Below please find the description of the main columns in the output tsv file "protein-diann_fdp_protein.csv":

Column name Description
protein protein ID (multiple IDs are separated by ";"). Each row is a protein group
q_value FDR reported by the search engine used to generate the result
score protein score used to rank protein for FDR calculation
combined_fdp the FDP estimated using the combined method
paired_fdp the FDP estimated using the paired method
lower_bound_fdp the lower bound FDP

The above example command line took about 5 seconds to run on a Mac MacBook computer.

Visualation FDR control evaluation result

R function "plot_fdp_fdr" used to generate an FDP vs FDR plot
library(tidyverse)
library(ggpubr)

plot_fdp_fdr=function(fdp_file="", # the FDP (in csv format) estimation file generated by FDRBench
                      fdr_max=NULL,
                      fig_title=NULL,
                      scale_xy=TRUE,
                      add_numbers=FALSE,
                      numbers_position=NULL,
                      numbers_font_size=11,
                      r=1,
                      fixed_fdr_max=FALSE,
                      max_x=NA,
                      max_y=NA,
                      color_mapping=NULL,
                      legend_position=c(0.7, 0.16),
                      legend_font_size=11,
                      fdr_decimal_place=2,
                      return_data=FALSE,
                      add_max_qvalue=FALSE) {
  if(is.null(color_mapping)){
    color_mapping <- c("Paired method" = "#7CAE00", "Sample method" = "#C77CFF", "Lower bound" = "#00BFC4", "Combined method" = "#F8766D")
  }
  x <- read_csv(fdp_file)
  if("paired_fdp" %in% names(x)){
    if(r>=2){
      dat <- x %>% select(q_value,combined_fdp,paired_fdp,lower_bound_fdp) %>% distinct() %>% 
        rename(`Combined method`=combined_fdp,`Matched method`=paired_fdp,`Lower bound`=lower_bound_fdp) %>%
        gather(key = "Method",value = "FDP",-`q_value`) %>% select(q_value,FDP,Method)
      dat$Method <- factor(dat$Method, levels = c("Combined method","Matched method","Lower bound"))
    }else{
      dat <- x %>% select(q_value,combined_fdp,paired_fdp,lower_bound_fdp) %>% distinct() %>% 
        rename(`Combined method`=combined_fdp,`Paired method`=paired_fdp,`Lower bound`=lower_bound_fdp) %>%
        gather(key = "Method",value = "FDP",-`q_value`) %>% select(q_value,FDP,Method)
      dat$Method <- factor(dat$Method, levels = c("Combined method","Paired method","Lower bound"))
    }
  }else{
    dat <- x %>% select(q_value,combined_fdp,lower_bound_fdp) %>% distinct() %>% 
      rename(`Combined method`=combined_fdp,`Lower bound`=lower_bound_fdp) %>%
      gather(key = "Method",value = "FDP",-`q_value`) %>% select(q_value,FDP,Method)
    dat$Method <- factor(dat$Method, levels = c("Combined method","Lower bound"))
  }
  
  
  max_fdp <- max(c(dat$FDP,dat$q_value))
  if(!is.null(fdr_max)){
    if(fixed_fdr_max){
      max_fdp <- fdr_max
    }else{
      max_fdp <- min(c(fdr_max,max_fdp))
    }
  }
  
  gg1 <- ggplot(dat,aes(x=q_value,y=FDP,color=Method)) + 
    geom_abline(slope = 1,intercept = 0,color="gray")+
    geom_line()+
    xlab("FDR threshold")+
    ylab("Estimated FDP")+
    theme_bw()+
    theme_pubr(base_size = 12,border = TRUE)
  
  if(!is.null(color_mapping)){
    gg1 <- gg1 + scale_color_manual(values = color_mapping)
  }
  
  if(scale_xy){
    
    if(!is.na(max_x) || !is.na(max_y)){
      gg1 <- gg1 + geom_vline(xintercept = 0.01,linetype=2,color="blue")
      if(!is.na(max_x)){
        gg1 <- gg1 + xlim(0,max_x) + scale_x_continuous(labels = scales::percent,limits =c(0,max_x))
      }else{
        gg1 <- gg1 + xlim(0,max_fdp)+ scale_x_continuous(labels = scales::percent,limits =c(0,max_fdp))
      }
      if(!is.na(max_y)){
        gg1 <- gg1 + ylim(0,max_y) + scale_y_continuous(labels = scales::percent,limits =c(0,max_y))
      }else{
        gg1 <- gg1 + ylim(0,max_fdp) + scale_y_continuous(labels = scales::percent,limits =c(0,max_fdp))
      }
    }else{
      gg1 <- gg1 + geom_vline(xintercept = 0.01,linetype=2,color="blue")+
        xlim(0,max_fdp)+
        ylim(0,max_fdp)+
        scale_y_continuous(labels = scales::percent,limits =c(0,max_fdp))+
        scale_x_continuous(labels = scales::percent,limits =c(0,max_fdp))
    }
  }
  
  gg1 <- gg1 + theme(legend.position="inside",
                     legend.position.inside = legend_position,
                     legend.background = element_blank(),
                     legend.text=element_text(size=legend_font_size),
                     legend.title=element_text(size=legend_font_size),
                     plot.margin = unit(2*c(0.1, 0.1, 0.1, 0.1),"inches"),
                     axis.text.y = element_text(angle = 90, hjust = 0.5))    
  
  
  if(!is.null(fig_title)){
    gg1 <- gg1 + ggtitle(fig_title)
  }
  
  added_numbers <- NULL
  if(add_numbers){
    if(fdr_decimal_place==1){
      y <- dat %>% filter(q_value<=0.01) %>% group_by(Method) %>% arrange(desc(q_value)) %>% filter(row_number()==1) %>% summarise(FDP001=max(FDP)) %>% mutate(ratio=sprintf("%.1f%%",FDP001*100))
    }else if(fdr_decimal_place==2){
      y <- dat %>% filter(q_value<=0.01) %>% group_by(Method) %>% arrange(desc(q_value)) %>% filter(row_number()==1) %>% summarise(FDP001=max(FDP)) %>% mutate(ratio=sprintf("%.2f%%",FDP001*100))
    }else{
      y <- dat %>% filter(q_value<=0.01) %>% group_by(Method) %>% arrange(desc(q_value)) %>% filter(row_number()==1) %>% summarise(FDP001=max(FDP)) %>% mutate(ratio=sprintf("%.4f%%",FDP001*100))
    }
    if(abs(max_fdp-0.01)<=0.02){
      added_numbers <- paste("Total discoveries:",nrow(x %>% filter(q_value<=0.01)),"\n",paste(y$Method,y$ratio,sep=":",collapse = "\n"),sep="")
      if(add_max_qvalue){
        added_numbers <- paste(added_numbers,"\n","Max q-value:",sprintf("%.2e",max(x$q_value)),sep="")
      }
      if(is.null(numbers_position)){
        gg1 <- gg1 + annotate("text", x = max_fdp*0.1, y = 0.9*max_fdp, label = added_numbers, color = "black", size = numbers_font_size/.pt,hjust = 0)
      }else{
        gg1 <- gg1 + annotate("text", x = numbers_position[1], y = numbers_position[2], label = added_numbers, color = "black", size = numbers_font_size/.pt,hjust = 0)
      }
      
    }else{
      added_numbers <- paste("Total discoveries:",nrow(x %>% filter(q_value<=0.01)),"\n",paste(y$Method,y$ratio,sep=":",collapse = "\n"),sep="")
      if(add_max_qvalue){
        added_numbers <- paste(added_numbers,"\n","Max q-value:",sprintf("%.2e",max(x$q_value)),sep="")
      }
      if(is.null(numbers_position)){
        gg1 <- gg1 + annotate("text", x = 0.01*1.05, y = 0.9*max_fdp, label = added_numbers, color = "black", size = numbers_font_size/.pt,hjust = 0)
      }else{
        gg1 <- gg1 + annotate("text", x = numbers_position[1], y = numbers_position[2], label = added_numbers, color = "black", size = numbers_font_size/.pt,hjust = 0)
      }
    }
  }
  

  if(return_data){
    return(list(gg=gg1,data=dat,added_numbers=added_numbers))
  }else{
    return(gg1)
  }
  
}

The following R code can be used to generate an FDR vesus FDP plot as shown below:

## load the above R function first before running the following R code.
fdp_plot <- plot_fdp_fdr("tide-peptide-percolator_fdp_peptide.csv",fdr_max = NULL,add_numbers = TRUE, fixed_fdr_max=TRUE)
pdf("fdr-fdp.pdf",width = 4.5,height = 4.5)
print(fdp_plot)
dev.off()
fdr-fdp

The dashed vertical line is at the 1% FDR threshold, as are the numbers reported in text in the figure.

How to cite:

Wen, B., Freestone, J., Riffle, M. et al. Assessment of false discovery rate control in tandem mass spectrometry analysis using entrapment. Nat Methods 22, 1454–1463 (2025).

About

Estimation of false discovery proportion for mass spectrometry proteomics data using entrapment

Resources

License

Stars

Watchers

Forks

Packages

No packages published

Contributors 2

  •  
  •  

Languages